PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00009.1.g06900.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 228aa    MW: 24986 Da    PI: 8.2535
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00009.1.g06900.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.13.9e-28116169155
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                     k+r++Wt eLH+rF+e+v+qL G + A+Pk+i+++m+v+g+t+ehv+SHLQkYRl
  Zjn_sc00009.1.g06900.1.am.mkhc 116 KARMVWTAELHHRFIEVVAQL-GDKAAVPKAIVQVMNVEGITREHVASHLQKYRL 169
                                     68*******************.99******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.774111172IPR017930Myb domain
SuperFamilySSF466892.87E-18114173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-28114173IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23116169IPR006447Myb domain, plants
PfamPF002495.0E-9118168IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MSSPRGGRPR DSPSPSSTSS PPPPPDMGTG RSECDRVLEW ESGLPTAAEL TPLSRPLIPR  60
ALAAAFRIGG VAGASDSPTS QLSLPWDDDD DDDEEEDRDR EMENAATGGG KPGKKKARMV  120
WTAELHHRFI EVVAQLGDKA AVPKAIVQVM NVEGITREHV ASHLQKYRLY LKRTRTTHAA  180
PPRLRVMPPT HGFSFSSQQS TDASERSDYC EKLQATRRRT SSPAVFKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-16113173262ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970554.12e-54PREDICTED: transcription factor PCL1-like
SwissprotQ94DH33e-37PCL1_ORYSJ; Transcription factor PCL1
TrEMBLK3XJE37e-53K3XJE3_SETIT; Uncharacterized protein
STRINGSi002016m2e-52(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.13e-25G2-like family protein